Lineage for d4gmsn2 (4gms N:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753050Domain d4gmsn2: 4gms N:108-213 [222008]
    Other proteins in same PDB: d4gmsa1, d4gmsa2, d4gmsb_, d4gmsc1, d4gmsc2, d4gmsd_, d4gmse1, d4gmse2, d4gmsf_, d4gmsh_, d4gmsi_, d4gmsj_, d4gmsl1, d4gmsm1, d4gmsn1
    automated match to d1tqbc2
    complexed with gol, nag, pg4, so4

Details for d4gmsn2

PDB Entry: 4gms (more details), 2.95 Å

PDB Description: crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
PDB Compounds: (N:) Fab S139/1 light chain

SCOPe Domain Sequences for d4gmsn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gmsn2 b.1.1.2 (N:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4gmsn2:

Click to download the PDB-style file with coordinates for d4gmsn2.
(The format of our PDB-style files is described here.)

Timeline for d4gmsn2: