| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4gmsn1: 4gms N:1-107 [222007] Other proteins in same PDB: d4gmsa1, d4gmsa2, d4gmsb_, d4gmsc1, d4gmsc2, d4gmsd_, d4gmse1, d4gmse2, d4gmsf_, d4gmsh_, d4gmsi_, d4gmsj_, d4gmsl2, d4gmsn2 automated match to d1a5fl1 complexed with gol, nag, pg4, so4 |
PDB Entry: 4gms (more details), 2.95 Å
SCOPe Domain Sequences for d4gmsn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gmsn1 b.1.1.0 (N:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleik
Timeline for d4gmsn1: