![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d4gmsl2: 4gms L:108-211 [222005] Other proteins in same PDB: d4gmsa1, d4gmsa2, d4gmsb_, d4gmsc1, d4gmsc2, d4gmsd_, d4gmse1, d4gmse2, d4gmsf_, d4gmsh_, d4gmsi_, d4gmsj_, d4gmsl1, d4gmsm1, d4gmsn1 automated match to d1tqbc2 complexed with gol, nag, pg4, so4 |
PDB Entry: 4gms (more details), 2.95 Å
SCOPe Domain Sequences for d4gmsl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gmsl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d4gmsl2: