SCOPe 2.03: Domain d4gmsl1: 4gms L:1-107

Lineage for d4gmsl1 (4gms L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d4gmsl1: 4gms L:1-107 [222004]
   Other proteins in same PDB: d4gmsa_, d4gmsc_, d4gmse_, d4gmsl2, d4gmsn2
   automated match to d1a5fl1
   complexed with gol, nag, pg4, so4

Details for d4gmsl1

PDB Entry: 4gms, 2.95 Å

PDB Description: crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin

PDB Compounds: (L:) Fab S139/1 light chain

SCOPe Domain Sequences for d4gmsl1:

Sequence; same for both SEQRES and ATOM records:

>d4gmsl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleik

Timeline for d4gmsl1:

• d4gmsl1 is new in SCOPe 2.03-stable
  
• d4gmsl1 appears in SCOPe 2.04
  
• d4gmsl1 appears in the current release, SCOPe 2.08