Lineage for d4gmsl1 (4gms L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297149Domain d4gmsl1: 4gms L:1-107 [222004]
    Other proteins in same PDB: d4gmsa_, d4gmsc_, d4gmse_, d4gmsl2, d4gmsn2
    automated match to d1a5fl1
    complexed with gol, nag, pg4, so4

Details for d4gmsl1

PDB Entry: 4gms (more details), 2.95 Å

PDB Description: crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
PDB Compounds: (L:) Fab S139/1 light chain

SCOPe Domain Sequences for d4gmsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gmsl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmstsvgdrvsvtckasqnvdtnvawyqekpgqspktliysasnrysgvpd
rftgsasgtdftltitnvqsedlaeyfcqqynsypytfgggtkleik

SCOPe Domain Coordinates for d4gmsl1:

Click to download the PDB-style file with coordinates for d4gmsl1.
(The format of our PDB-style files is described here.)

Timeline for d4gmsl1: