Lineage for d4gmse1 (4gms E:11-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775910Domain d4gmse1: 4gms E:11-325 [222003]
    Other proteins in same PDB: d4gmsa2, d4gmsb_, d4gmsc2, d4gmsd_, d4gmse2, d4gmsf_, d4gmsh_, d4gmsi_, d4gmsj_, d4gmsl1, d4gmsl2, d4gmsm1, d4gmsn1, d4gmsn2
    automated match to d1kena_
    complexed with gol, nag, pg4, so4

Details for d4gmse1

PDB Entry: 4gms (more details), 2.95 Å

PDB Description: crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4gmse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gmse1 b.19.1.2 (E:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlidal
lgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtgv
tqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdke
qtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsngn
liaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

SCOPe Domain Coordinates for d4gmse1:

Click to download the PDB-style file with coordinates for d4gmse1.
(The format of our PDB-style files is described here.)

Timeline for d4gmse1: