Lineage for d4gmsc_ (4gms C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778315Domain d4gmsc_: 4gms C: [222002]
    Other proteins in same PDB: d4gmsb_, d4gmsd_, d4gmsf_, d4gmsl1, d4gmsl2, d4gmsm1, d4gmsn1, d4gmsn2
    automated match to d1kena_
    complexed with gol, nag, pg4, so4

Details for d4gmsc_

PDB Entry: 4gms (more details), 2.95 Å

PDB Description: Crystal structure of heterosubtypic Fab S139/1 in complex with influenza A H3 hemagglutinin
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4gmsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gmsc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlida
llgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwtg
vtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstdk
eqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsng
nliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpkyv
kqntlklatgmrnvpe

SCOPe Domain Coordinates for d4gmsc_:

Click to download the PDB-style file with coordinates for d4gmsc_.
(The format of our PDB-style files is described here.)

Timeline for d4gmsc_: