Lineage for d1edhb1 (1edh B:3-101)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768951Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1768966Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 1768976Domain d1edhb1: 1edh B:3-101 [22200]
    two-domain fragment
    complexed with ca, hg

Details for d1edhb1

PDB Entry: 1edh (more details), 2 Å

PDB Description: e-cadherin domains 1 and 2 in complex with calcium
PDB Compounds: (B:) e-cadherin

SCOPe Domain Sequences for d1edhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edhb1 b.1.6.1 (B:3-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
vippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkv
tqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d1edhb1:

Click to download the PDB-style file with coordinates for d1edhb1.
(The format of our PDB-style files is described here.)

Timeline for d1edhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1edhb2