Lineage for d4glqa_ (4glq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970326Species Thermosynechococcus elongatus [TaxId:197221] [197087] (8 PDB entries)
  8. 2970329Domain d4glqa_: 4glq A: [221992]
    automated match to d4fofa_
    complexed with vrb

Details for d4glqa_

PDB Entry: 4glq (more details), 1.77 Å

PDB Description: crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain
PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d4glqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4glqa_ d.110.2.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardqviedpcf
rehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfglliahqa
seprqwqeieidqfselastgslvlerlh

SCOPe Domain Coordinates for d4glqa_:

Click to download the PDB-style file with coordinates for d4glqa_.
(The format of our PDB-style files is described here.)

Timeline for d4glqa_: