![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
![]() | Protein automated matches [190838] (19 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [197087] (8 PDB entries) |
![]() | Domain d4glqa_: 4glq A: [221992] automated match to d4fofa_ complexed with vrb |
PDB Entry: 4glq (more details), 1.77 Å
SCOPe Domain Sequences for d4glqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4glqa_ d.110.2.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} elrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardqviedpcf rehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfglliahqa seprqwqeieidqfselastgslvlerlh
Timeline for d4glqa_: