Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Burkholderia multivorans [TaxId:395019] [226459] (5 PDB entries) |
Domain d4glob_: 4glo B: [221989] automated match to d1gcoa_ complexed with cl, edo, nad, so4 |
PDB Entry: 4glo (more details), 1.8 Å
SCOPe Domain Sequences for d4glob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4glob_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]} mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt gewlfvdggythldralv
Timeline for d4glob_: