Lineage for d4gloa_ (4glo A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350237Species Burkholderia multivorans [TaxId:395019] [226459] (3 PDB entries)
  8. 1350246Domain d4gloa_: 4glo A: [221988]
    automated match to d1gcoa_
    complexed with cl, edo, nad, so4

Details for d4gloa_

PDB Entry: 4glo (more details), 1.8 Å

PDB Description: Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4gloa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gloa_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mdlnlqdkvvivtggasgiggaismrlaeeraipvvfarhapdgafldalaqrqpratyl
pvelqddaqcrdavaqtiatfgrldglvnnagvndgigldagrdafvaslernlihyyam
ahycvphlkatrgaivnissktavtgqgntsgycaskgaqlaltrewavalrehgvrvna
vipaevmtplyrnwiatfedpeaklaeiaakvplgrrfttpdeiadtavfllsprashtt
gewlfvdggythldralv

SCOPe Domain Coordinates for d4gloa_:

Click to download the PDB-style file with coordinates for d4gloa_.
(The format of our PDB-style files is described here.)

Timeline for d4gloa_: