SCOPe 2.03: Domain d4glla_: 4gll A:

Lineage for d4glla_ (4gll A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)

8. Domain d4glla_: 4gll A: [221986]
   automated match to d2hunb_
   complexed with gai, nad, so4

Details for d4glla_

PDB Entry: 4gll, 2.5 Å

PDB Description: crystal structure of human udp-xylose synthase.

PDB Compounds: (A:) UDP-glucuronic acid decarboxylase 1

SCOPe Domain Sequences for d4glla_:

Sequence; same for both SEQRES and ATOM records:

>d4glla_ c.2.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
plyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevyg
dpevhpqsedywghvnpigpracydegkrvaetmcyaymkqegvevrvarifntfgprmh
mndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpe
ehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleeglnka
ihyfrke

Timeline for d4glla_:

• d4glla_ is new in SCOPe 2.03-stable
  
• d4glla_ appears in SCOPe 2.04
  
• d4glla_ appears in the current release, SCOPe 2.08