SCOPe 2.08: Domain d4gkza2: 4gkz A:116-201

Lineage for d4gkza2 (4gkz A:116-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4gkza2: 4gkz A:116-201 [221980]
   Other proteins in same PDB: d4gkza1, d4gkzb1
   automated match to d1j8hd2
   complexed with edo, so4, tam

Details for d4gkza2

PDB Entry: 4gkz, 2.39 Å

PDB Description: HA1.7, a MHC class II restricted TCR specific for haemagglutinin

PDB Compounds: (A:) Alpha chain of Class II TCR

SCOPe Domain Sequences for d4gkza2:

Sequence; same for both SEQRES and ATOM records:

>d4gkza2 b.1.1.2 (A:116-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Timeline for d4gkza2:

• d4gkza2 first appeared in SCOPe 2.03
  
• d4gkza2 appears in SCOPe 2.07