![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.1: Cadherin [49314] (4 proteins) |
![]() | Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries) |
![]() | Domain d1edha1: 1edh A:3-101 [22198] two-domain fragment complexed with ca, hg |
PDB Entry: 1edh (more details), 2 Å
SCOPe Domain Sequences for d1edha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edha1 b.1.6.1 (A:3-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} vippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkv tqpldreaiakyilyshavssngeavedpmeivitvtdq
Timeline for d1edha1: