SCOPe 2.03: Domain d4gkza1: 4gkz A:0-115

Lineage for d4gkza1 (4gkz A:0-115)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d4gkza1: 4gkz A:0-115 [221979]
   Other proteins in same PDB: d4gkza2, d4gkzb2
   automated match to d1j8hd1
   complexed with edo, so4, tam

Details for d4gkza1

PDB Entry: 4gkz, 2.39 Å

PDB Description: HA1.7, a MHC class II restricted TCR specific for haemagglutinin

PDB Compounds: (A:) Alpha chain of Class II TCR

SCOPe Domain Sequences for d4gkza1:

Sequence; same for both SEQRES and ATOM records:

>d4gkza1 b.1.1.1 (A:0-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
ngfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

Timeline for d4gkza1:

• d4gkza1 is new in SCOPe 2.03-stable
  
• d4gkza1 appears in SCOPe 2.04
  
• d4gkza1 appears in the current release, SCOPe 2.08