Lineage for d4gk6a1 (4gk6 A:2-133)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083305Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2083459Protein automated matches [190798] (8 species)
    not a true protein
  7. 2083478Species Mycobacterium abscessus [TaxId:561007] [226542] (1 PDB entry)
  8. 2083479Domain d4gk6a1: 4gk6 A:2-133 [221973]
    Other proteins in same PDB: d4gk6a2
    automated match to d1sjnb_
    complexed with cl

Details for d4gk6a1

PDB Entry: 4gk6 (more details), 1.65 Å

PDB Description: x-ray crystal structure of a hypothetical deoxyuridine 5-triphosphate nucleotidohydrolase from mycobacterium abscessus
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d4gk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gk6a1 b.85.4.1 (A:2-133) automated matches {Mycobacterium abscessus [TaxId: 561007]}
aivrldrelplpsrahaddagvdlysaedvviepgrrtlvgtgiavaipsgmvglvhprs
glaarvglsivnspgtidagyrgevkvnlinldsevpiviargdriaqllvqqvelpelv
evdsfdeaglav

SCOPe Domain Coordinates for d4gk6a1:

Click to download the PDB-style file with coordinates for d4gk6a1.
(The format of our PDB-style files is described here.)

Timeline for d4gk6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gk6a2