Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (8 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [226542] (1 PDB entry) |
Domain d4gk6a1: 4gk6 A:2-133 [221973] Other proteins in same PDB: d4gk6a2 automated match to d1sjnb_ complexed with cl |
PDB Entry: 4gk6 (more details), 1.65 Å
SCOPe Domain Sequences for d4gk6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gk6a1 b.85.4.1 (A:2-133) automated matches {Mycobacterium abscessus [TaxId: 561007]} aivrldrelplpsrahaddagvdlysaedvviepgrrtlvgtgiavaipsgmvglvhprs glaarvglsivnspgtidagyrgevkvnlinldsevpiviargdriaqllvqqvelpelv evdsfdeaglav
Timeline for d4gk6a1: