SCOPe 2.07: Domain d1ncja2: 1ncj A:102-215

Lineage for d1ncja2 (1ncj A:102-215)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein N-cadherin (neural) [49315] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)

8. Domain d1ncja2: 1ncj A:102-215 [22197]
   two-domain fragment
   complexed with ca, ium

Details for d1ncja2

PDB Entry: 1ncj, 3.4 Å

PDB Description: n-cadherin, two-domain fragment

PDB Compounds: (A:) protein (n-cadherin)

SCOPe Domain Sequences for d1ncja2:

Sequence; same for both SEQRES and ATOM records:

>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrivsqapstpspnm
ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd

Timeline for d1ncja2:

• d1ncja2 first appeared (with stable ids) in SCOP 1.55
  
• d1ncja2 appears in SCOPe 2.06
  
• d1ncja2 appears in the current release, SCOPe 2.08