Lineage for d1ncja2 (1ncj A:102-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10068Superfamily b.1.6: Cadherin [49313] (1 family) (S)
  5. 10069Family b.1.6.1: Cadherin [49314] (2 proteins)
  6. 10081Protein N-cadherin (neural) [49315] (1 species)
  7. 10082Species Mouse (Mus musculus) [TaxId:10090] [49316] (4 PDB entries)
  8. 10089Domain d1ncja2: 1ncj A:102-215 [22197]

Details for d1ncja2

PDB Entry: 1ncj (more details), 3.4 Å

PDB Description: n-cadherin, two-domain fragment

SCOP Domain Sequences for d1ncja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus)}
ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrivsqapstpspnm
ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd

SCOP Domain Coordinates for d1ncja2:

Click to download the PDB-style file with coordinates for d1ncja2.
(The format of our PDB-style files is described here.)

Timeline for d1ncja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ncja1