| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein N-cadherin (neural) [49315] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries) |
| Domain d1ncja1: 1ncj A:2-101 [22196] two-domain fragment complexed with ca, ium |
PDB Entry: 1ncj (more details), 3.4 Å
SCOPe Domain Sequences for d1ncja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncja1 b.1.6.1 (A:2-101) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
wvippinlpensrgpfpqelvrirsdrdknlslrysvtgpgadqpptgifiinpisgqls
vtkpldreliarfhlrahavdingnqvenpidivinvidm
Timeline for d1ncja1: