SCOP 1.75: Domain d1ncja1: 1ncj A:2-101

Lineage for d1ncja1 (1ncj A:2-101)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (2 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein N-cadherin (neural) [49315] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)

8. Domain d1ncja1: 1ncj A:2-101 [22196]
   two-domain fragment

Details for d1ncja1

PDB Entry: 1ncj, 3.4 Å

PDB Description: n-cadherin, two-domain fragment

PDB Compounds: (A:) protein (n-cadherin)

SCOP Domain Sequences for d1ncja1:

Sequence; same for both SEQRES and ATOM records:

>d1ncja1 b.1.6.1 (A:2-101) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
wvippinlpensrgpfpqelvrirsdrdknlslrysvtgpgadqpptgifiinpisgqls
vtkpldreliarfhlrahavdingnqvenpidivinvidm

Timeline for d1ncja1:

• d1ncja1 first appeared (with stable ids) in SCOP 1.55
  
• d1ncja1 appears in SCOP 1.73
  
• d1ncja1 appears in SCOPe 2.01
  
• d1ncja1 appears in the current release, SCOPe 2.08