SCOPe 2.06: Domain d4gjha_: 4gjh A:

Lineage for d4gjha_ (4gjh A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.0: automated matches [227285] (1 protein)
   not a true family

6. Protein automated matches [227102] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226532] (1 PDB entry)

8. Domain d4gjha_: 4gjh A: [221957]
   automated match to d1lb4a_

Details for d4gjha_

PDB Entry: 4gjh, 2.81 Å

PDB Description: Crystal Structure of the TRAF domain of TRAF5

PDB Compounds: (A:) TNF receptor-associated factor 5

SCOPe Domain Sequences for d4gjha_:

Sequence; same for both SEQRES and ATOM records:

>d4gjha_ b.8.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hkaqlnkneerfkqlegacysgkliwkvtdyrvkkreaveghtvsvfsqpfytsrcgyrl
caraylngdgsgkgthlslyfvvmrgefdsllqwpfrqrvtlmlldqsgkknhivetfka
dpnsssfkrpdgemniasgcprfvshstlenskntyikddtlflkvavdltdled

Timeline for d4gjha_:

• d4gjha_ first appeared in SCOPe 2.03
  
• d4gjha_ appears in SCOPe 2.05
  
• d4gjha_ appears in SCOPe 2.07
  
• d4gjha_ appears in the current release, SCOPe 2.08