Lineage for d1nchb_ (1nch B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1769013Protein N-cadherin (neural) [49315] (1 species)
  7. 1769014Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 1769019Domain d1nchb_: 1nch B: [22195]
    domain 1
    complexed with yb

Details for d1nchb_

PDB Entry: 1nch (more details), 2.1 Å

PDB Description: structural basis of cell-cell adhesion by cadherins
PDB Compounds: (B:) n-cadherin

SCOPe Domain Sequences for d1nchb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nchb_ b.1.6.1 (B:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisgql
svtkpldreliarfhlrahavdingnqvenpidivinvid

SCOPe Domain Coordinates for d1nchb_:

Click to download the PDB-style file with coordinates for d1nchb_.
(The format of our PDB-style files is described here.)

Timeline for d1nchb_: