Lineage for d1ncha_ (1nch A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037271Protein N-cadherin (neural) [49315] (1 species)
  7. 2037272Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 2037276Domain d1ncha_: 1nch A: [22194]
    domain 1
    complexed with yb

Details for d1ncha_

PDB Entry: 1nch (more details), 2.1 Å

PDB Description: structural basis of cell-cell adhesion by cadherins
PDB Compounds: (A:) n-cadherin

SCOPe Domain Sequences for d1ncha_:

Sequence, based on SEQRES records: (download)

>d1ncha_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
gsdwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisg
qlsvtkpldreliarfhlrahavdingnqvenpidivinvi

Sequence, based on observed residues (ATOM records): (download)

>d1ncha_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
gsdwvippinlpensgpfpqelvrirsgrdlslrysvtgpgadqpptgifiinpisgqls
vtkpldreliarfhlrahavdingnqvenpidivinvi

SCOPe Domain Coordinates for d1ncha_:

Click to download the PDB-style file with coordinates for d1ncha_.
(The format of our PDB-style files is described here.)

Timeline for d1ncha_: