Lineage for d1ncha_ (1nch A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.6: Cadherin [49313] (1 family) 
Family b.1.6.1: Cadherin [49314] (2 proteins) Protein N-cadherin (neural) [49315] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49316] (4 PDB entries) 
Domain d1ncha_: 1nch A: [22194]
Details for d1ncha_
PDB Entry: 1nch (more details), 2.1 Å
PDB Description: structural basis of cell-cell adhesion by cadherins
SCOP Domain Sequences for d1ncha_:
Sequence, based on SEQRES records: (download)
>d1ncha_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus)}
gsdwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisg
qlsvtkpldreliarfhlrahavdingnqvenpidivinvi
Sequence, based on observed residues (ATOM records): (download)
>d1ncha_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus)}
gsdwvippinlpensgpfpqelvrirsgrdlslrysvtgpgadqpptgifiinpisgqls
vtkpldreliarfhlrahavdingnqvenpidivinvi
SCOP Domain Coordinates for d1ncha_:
Click to download the PDB-style file with coordinates for d1ncha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ncha_:
- d1ncha_ appears in SCOP 1.57
- d1ncha_ appears in the current release, SCOPe 2.08
View in 3D
