SCOPe 2.06: Domain d4gj0c_: 4gj0 C:

Lineage for d4gj0c_ (4gj0 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d4gj0c_: 4gj0 C: [221935]
   automated match to d2ox9b_
   complexed with gol, so4; mutant

Details for d4gj0c_

PDB Entry: 4gj0, 1.95 Å

PDB Description: Crystal structure of CD23 lectin domain mutant S252A

PDB Compounds: (C:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gj0c_:

Sequence; same for both SEQRES and ATOM records:

>d4gj0c_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtg
swiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrklg
awvcdrlatctp

Timeline for d4gj0c_:

• d4gj0c_ first appeared in SCOPe 2.03
  
• d4gj0c_ appears in SCOPe 2.05
  
• d4gj0c_ appears in SCOPe 2.07
  
• d4gj0c_ appears in the current release, SCOPe 2.08