SCOPe 2.04: Domain d4gj0a_: 4gj0 A:

Lineage for d4gj0a_ (4gj0 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)

8. Domain d4gj0a_: 4gj0 A: [221933]
   automated match to d2ox9b_
   complexed with gol, so4; mutant

Details for d4gj0a_

PDB Entry: 4gj0, 1.95 Å

PDB Description: Crystal structure of CD23 lectin domain mutant S252A

PDB Compounds: (A:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4gj0a_:

Sequence; same for both SEQRES and ATOM records:

>d4gj0a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptarsqgedcvmmrgsgrwndafcdrk
lgawvcdrlatctpp

Timeline for d4gj0a_:

• d4gj0a_ first appeared in SCOPe 2.03
  
• d4gj0a_ appears in SCOPe 2.05
  
• d4gj0a_ appears in the current release, SCOPe 2.08