Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (18 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226444] (2 PDB entries) |
Domain d4giea_: 4gie A: [221931] automated match to d1xjba_ complexed with act, nap |
PDB Entry: 4gie (more details), 1.25 Å
SCOPe Domain Sequences for d4giea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4giea_ c.1.7.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]} ahhhhhhmncnyncvtlhnsvrmpqlglgvwraqdgaetanavrwaieagyrhidtayiy snergvgqgiresgvpreevwvttkvwnsdqgyektlaafersrellgleyidlylihwp gkkkfvdtwkaleklyeekkvraigvsnfephhltelfksckirpmvnqvelhplfqqrt lrefckqhniaitawsplgsgeeagilknhvlgeiakkhnkspaqvvirwdiqhgivtip kstnkgriqenfnvwdfklteeemrqidelnedkrigadpdnffpgge
Timeline for d4giea_: