SCOPe 2.03: Domain d4giea_: 4gie A:

Lineage for d4giea_ (4gie A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (18 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226444] (2 PDB entries)

8. Domain d4giea_: 4gie A: [221931]
   automated match to d1xjba_
   complexed with act, nap

Details for d4giea_

PDB Entry: 4gie, 1.25 Å

PDB Description: crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to nadp

PDB Compounds: (A:) prostaglandin F synthase

SCOPe Domain Sequences for d4giea_:

Sequence; same for both SEQRES and ATOM records:

>d4giea_ c.1.7.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ahhhhhhmncnyncvtlhnsvrmpqlglgvwraqdgaetanavrwaieagyrhidtayiy
snergvgqgiresgvpreevwvttkvwnsdqgyektlaafersrellgleyidlylihwp
gkkkfvdtwkaleklyeekkvraigvsnfephhltelfksckirpmvnqvelhplfqqrt
lrefckqhniaitawsplgsgeeagilknhvlgeiakkhnkspaqvvirwdiqhgivtip
kstnkgriqenfnvwdfklteeemrqidelnedkrigadpdnffpgge

Timeline for d4giea_:

• d4giea_ is new in SCOPe 2.03-stable
  
• d4giea_ appears in SCOPe 2.04
  
• d4giea_ appears in the current release, SCOPe 2.08, called d4giea1