Lineage for d1ncg__ (1ncg -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.6: Cadherin [49313] (1 family) 
Family b.1.6.1: Cadherin [49314] (2 proteins) Protein N-cadherin (neural) [49315] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49316] (4 PDB entries) 
Domain d1ncg__: 1ncg - [22193]
Details for d1ncg__
PDB Entry: 1ncg (more details), 1.9 Å
PDB Description: structural basis of cell-cell adhesion by cadherins
SCOP Domain Sequences for d1ncg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncg__ b.1.6.1 (-) N-cadherin (neural) {Mouse (Mus musculus)}
dwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisgql
svtkpldreliarfhlrahavdingnqvenpidivinvi
SCOP Domain Coordinates for d1ncg__:
Click to download the PDB-style file with coordinates for d1ncg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ncg__:
- d1ncg__ first appeared (with stable ids) in SCOP 1.55
- d1ncg__ appears in SCOP 1.59
- d1ncg__ appears in the current release, SCOPe 2.08, called d1ncga_
View in 3D