SCOPe 2.08: Domain d1ncga_: 1ncg A:

Lineage for d1ncga_ (1ncg A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein N-cadherin (neural) [49315] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)

8. Domain d1ncga_: 1ncg A: [22193]
   domain 1
   complexed with yb

Details for d1ncga_

PDB Entry: 1ncg, 2.1 Å

PDB Description: structural basis of cell-cell adhesion by cadherins

PDB Compounds: (A:) n-cadherin

SCOPe Domain Sequences for d1ncga_:

Sequence; same for both SEQRES and ATOM records:

>d1ncga_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
dwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisgql
svtkpldreliarfhlrahavdingnqvenpidivinvi

Timeline for d1ncga_:

• d1ncga_ first appeared (with stable ids) in SCOP 1.55, called d1ncg__
  
• d1ncga_ appears in SCOPe 2.07