Lineage for d4gi7d_ (4gi7 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866582Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 2866642Protein automated matches [227115] (2 species)
    not a true protein
  7. 2866646Species Klebsiella pneumoniae [TaxId:507522] [226631] (3 PDB entries)
  8. 2866650Domain d4gi7d_: 4gi7 D: [221926]
    automated match to d1esma_
    complexed with 0jr, adp, unx

Details for d4gi7d_

PDB Entry: 4gi7 (more details), 1.95 Å

PDB Description: Crystal structure of Klebsiella pneumoniae pantothenate kinase in complex with a pantothenate analogue
PDB Compounds: (D:) pantothenate kinase

SCOPe Domain Sequences for d4gi7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gi7d_ c.37.1.6 (D:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
mtpylqfnrhqwaalrdsvpmtltedeitrlkginedlsleevaeiylplsrllnfyiss
nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrhvelittdg
flhpnsvlkerglmkkkgfpqsydmhrlvkfvsdlksgvpqatapvyshliydvipdgdk
tvaqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapeellkswyinrflkfr
egaftdpdsyfhnyaklskeeavdiatslwneinlmnlkenilptreraslimtksanhs
vnqvrlrk

SCOPe Domain Coordinates for d4gi7d_:

Click to download the PDB-style file with coordinates for d4gi7d_.
(The format of our PDB-style files is described here.)

Timeline for d4gi7d_: