SCOPe 2.06: Domain d4ghta1: 4ght A:1-180

Lineage for d4ghta1 (4ght A:1-180)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [189708] (7 PDB entries)

8. Domain d4ghta1: 4ght A:1-180 [221918]
   Other proteins in same PDB: d4ghta2, d4ghtb2
   automated match to d3zv9a_
   complexed with ag7

Details for d4ghta1

PDB Entry: 4ght, 1.96 Å

PDB Description: Crystal structure of EV71 3C proteinase in complex with AG7088

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d4ghta1:

Sequence; same for both SEQRES and ATOM records:

>d4ghta1 b.47.1.0 (A:1-180) automated matches {Human enterovirus 71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnildav
elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfa

Timeline for d4ghta1:

• d4ghta1 first appeared in SCOPe 2.03, called d4ghta_
  
• d4ghta1 was called d4ghta_ in SCOPe 2.05
  
• d4ghta1 appears in SCOPe 2.07
  
• d4ghta1 appears in the current release, SCOPe 2.08