Lineage for d4ghob_ (4gho B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923990Protein automated matches [190834] (3 species)
    not a true protein
  7. 2923999Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2924001Domain d4ghob_: 4gho B: [221916]
    automated match to d1boxa_
    complexed with so4; mutant

Details for d4ghob_

PDB Entry: 4gho (more details), 1.1 Å

PDB Description: Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
PDB Compounds: (B:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4ghob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ghob_ d.1.1.2 (B:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d4ghob_:

Click to download the PDB-style file with coordinates for d4ghob_.
(The format of our PDB-style files is described here.)

Timeline for d4ghob_: