SCOPe 2.07: Domain d4ghob_: 4gho B:

Lineage for d4ghob_ (4gho B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 protein domains)

6. Protein automated matches [190834] (2 species)
   not a true protein

7. Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)

8. Domain d4ghob_: 4gho B: [221916]
   automated match to d1boxa_
   complexed with so4; mutant

Details for d4ghob_

PDB Entry: 4gho, 1.1 Å

PDB Description: Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant

PDB Compounds: (B:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4ghob_:

Sequence; same for both SEQRES and ATOM records:

>d4ghob_ d.1.1.2 (B:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

Timeline for d4ghob_:

• d4ghob_ first appeared in SCOPe 2.03
  
• d4ghob_ appears in SCOPe 2.06