SCOPe 2.07: Domain d4ghoa_: 4gho A:

Lineage for d4ghoa_ (4gho A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein automated matches [190834] (3 species)
   not a true protein

7. Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)

8. Domain d4ghoa_: 4gho A: [221915]
   automated match to d1boxa_
   complexed with so4; mutant

Details for d4ghoa_

PDB Entry: 4gho, 1.1 Å

PDB Description: Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant

PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4ghoa_:

Sequence; same for both SEQRES and ATOM records:

>d4ghoa_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

Timeline for d4ghoa_:

• d4ghoa_ first appeared in SCOPe 2.03
  
• d4ghoa_ appears in SCOPe 2.06
  
• d4ghoa_ appears in the current release, SCOPe 2.08