SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ghoa_ (4gho A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152204Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2152205Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2152206Family d.1.1.2: Bacterial ribonucleases [81307] (6 protein domains)
  6. 2152401Protein automated matches [190834] (2 species)
    not a true protein
  7. 2152407Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2152408Domain d4ghoa_: 4gho A: [221915]
    automated match to d1boxa_
    complexed with so4; mutant

Details for d4ghoa_

PDB Entry: 4gho (more details), 1.1 Å

PDB Description: Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4ghoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ghoa_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d4ghoa_:

Click to download the PDB-style file with coordinates for d4ghoa_.
(The format of our PDB-style files is described here.)

Timeline for d4ghoa_: