Lineage for d4ghoa_ (4gho A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152204Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2152205Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2152206Family d.1.1.2: Bacterial ribonucleases [81307] (6 protein domains)
  6. 2152401Protein automated matches [190834] (2 species)
    not a true protein
  7. 2152407Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2152408Domain d4ghoa_: 4gho A: [221915]
    automated match to d1boxa_
    complexed with so4; mutant

Details for d4ghoa_

PDB Entry: 4gho (more details), 1.1 Å

PDB Description: Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4ghoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ghoa_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliaadgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d4ghoa_:

Click to download the PDB-style file with coordinates for d4ghoa_.
(The format of our PDB-style files is described here.)

Timeline for d4ghoa_: