SCOPe 2.06: Domain d4ghhb2: 4ghh B:148-362

Lineage for d4ghhb2 (4ghh B:148-362)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)

8. Domain d4ghhb2: 4ghh B:148-362 [221910]
   automated match to d1q0oa2
   complexed with 4nc, ca, cl, fe2, p6g, peg, pg4

Details for d4ghhb2

PDB Entry: 4ghh, 1.55 Å

PDB Description: Structure of Homoprotocatechuate 2,3-Dioxygenase from B.fuscum in complex with 4-Nitrocatechol at 1.55 Ang resolution

PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d4ghhb2:

Sequence; same for both SEQRES and ATOM records:

>d4ghhb2 d.32.1.3 (B:148-362) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgfklg

Timeline for d4ghhb2:

• d4ghhb2 first appeared in SCOPe 2.03
  
• d4ghhb2 appears in SCOPe 2.05
  
• d4ghhb2 appears in SCOPe 2.07
  
• d4ghhb2 appears in the current release, SCOPe 2.08