SCOP 1.75: Domain d1ncia_: 1nci A:

Lineage for d1ncia_ (1nci A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (2 families)

5. Family b.1.6.1: Cadherin [49314] (3 proteins)

6. Protein N-cadherin (neural) [49315] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)

8. Domain d1ncia_: 1nci A: [22191]
   domain 1

Details for d1ncia_

PDB Entry: 1nci, 2.1 Å

PDB Description: structural basis of cell-cell adhesion by cadherins

PDB Compounds: (A:) n-cadherin

SCOP Domain Sequences for d1ncia_:

Sequence; same for both SEQRES and ATOM records:

>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
gsdwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisg
qlsvtkpldreliarfhlrahavdingnqvenpidivinvid

Timeline for d1ncia_:

• d1ncia_ first appeared (with stable ids) in SCOP 1.55
  
• d1ncia_ appears in SCOP 1.73
  
• d1ncia_ appears in SCOPe 2.01
  
• d1ncia_ appears in the current release, SCOPe 2.08