SCOPe 2.05: Domain d4ghgb1: 4ghg B:3-147

Lineage for d4ghgb1 (4ghg B:3-147)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Brevibacterium fuscum [TaxId:47914] [89888] (15 PDB entries)

8. Domain d4ghgb1: 4ghg B:3-147 [221901]
   automated match to d1q0oa1
   complexed with ca, cl, dhy, fe2, p6g, pg4

Details for d4ghgb1

PDB Entry: 4ghg, 1.5 Å

PDB Description: Structure of Homoprotocatechuate 2,3-Dioxygenase from B.fuscum in complex with HPCA at 1.50 Ang resolution

PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d4ghgb1:

Sequence; same for both SEQRES and ATOM records:

>d4ghgb1 d.32.1.3 (B:3-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
neipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihh
nlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedpl
gfpyefffetthverlhmrydlysa

Timeline for d4ghgb1:

• d4ghgb1 first appeared in SCOPe 2.03
  
• d4ghgb1 appears in SCOPe 2.04
  
• d4ghgb1 appears in SCOPe 2.06
  
• d4ghgb1 appears in the current release, SCOPe 2.08