Lineage for d1qrkb3 (1qrk B:628-727)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10036Superfamily b.1.5: Transglutaminase [49309] (1 family) (S)
  5. 10037Family b.1.5.1: Transglutaminase [49310] (1 protein)
  6. 10038Protein Coagulation factor XIII, two C-terminal domains [49311] (1 species)
  7. 10039Species Human (Homo sapiens), blood [TaxId:9606] [49312] (7 PDB entries)
  8. 10063Domain d1qrkb3: 1qrk B:628-727 [22190]
    Other proteins in same PDB: d1qrka1, d1qrka4, d1qrkb1, d1qrkb4

Details for d1qrkb3

PDB Entry: 1qrk (more details), 2.5 Å

PDB Description: human factor xiii with strontium bound in the ion site
PDB Compounds: (B:)

SCOP Domain Sequences for d1qrkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrkb3 b.1.5.1 (B:628-727) Coagulation factor XIII, two C-terminal domains {Human (Homo sapiens), blood}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOP Domain Coordinates for d1qrkb3:

Click to download the PDB-style file with coordinates for d1qrkb3.
(The format of our PDB-style files is described here.)

Timeline for d1qrkb3: