SCOPe 2.08: Domain d4ggla1: 4ggl A:18-224

Lineage for d4ggla1 (4ggl A:18-224)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)

8. Domain d4ggla1: 4ggl A:18-224 [221894]
   Other proteins in same PDB: d4ggla2
   automated match to d1kzna_
   protein/DNA complex; complexed with cjc, gol

Details for d4ggla1

PDB Entry: 4ggl, 1.69 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4ggla1:

Sequence, based on SEQRES records:

>d4ggla1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy
kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela
flnrglhisiedrregqedkkeyhyeg

Sequence, based on observed residues (ATOM records):

>d4ggla1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhgvgssvvnalstsldvrvykdgkvyyqeyrrgavvd
dlkvieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregq
edkkeyhyeg

Timeline for d4ggla1:

• d4ggla1 first appeared in SCOPe 2.03, called d4ggla_
  
• d4ggla1 appears in SCOPe 2.07