SCOPe 2.08: Domain d4gftb1: 4gft B:2-125

Lineage for d4gftb1 (4gft B:2-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4gftb1: 4gft B:2-125 [221890]
   Other proteins in same PDB: d4gfta_, d4gftb2
   automated match to d4aq1b_
   complexed with edo

Details for d4gftb1

PDB Entry: 4gft, 1.6 Å

PDB Description: malaria invasion machinery protein-nanobody complex

PDB Compounds: (B:) Nanobody

SCOPe Domain Sequences for d4gftb1:

Sequence; same for both SEQRES and ATOM records:

>d4gftb1 b.1.1.1 (B:2-125) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlqesgggtvqpggslklscsaaperafsnyamgwfrqapgqerefvagitgsgrsqy
yadsvkgrftisrdnamnavylqmnsvkaedtavyycaarvvpvfsdstkgyvywgqgtq
vtvs

Timeline for d4gftb1:

• d4gftb1 first appeared in SCOPe 2.03, called d4gftb_
  
• d4gftb1 was called d4gftb_ in SCOPe 2.07