SCOPe 2.08: Domain d4gfqa1: 4gfq A:1-185

Lineage for d4gfqa1 (4gfq A:1-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families)
   automatically mapped to Pfam PF01765

5. Family d.67.3.0: automated matches [227278] (1 protein)
   not a true family

6. Protein automated matches [227087] (4 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226443] (1 PDB entry)

8. Domain d4gfqa1: 4gfq A:1-185 [221888]
   Other proteins in same PDB: d4gfqa2
   automated match to d1is1a_
   complexed with cl, gol, peg, po4

Details for d4gfqa1

PDB Entry: 4gfq, 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of ribosome recycling factor (frr) from bacillus anthracis

PDB Compounds: (A:) Ribosome-recycling factor

SCOPe Domain Sequences for d4gfqa1:

Sequence; same for both SEQRES and ATOM records:

>d4gfqa1 d.67.3.0 (A:1-185) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mgqqvlkfsnekmekavaaysrelatvragrasasvldkvqvdyygaptpvvqlanitvp
earllviqpydktsigdiekailkadlglnpsndgtviriafpalteerrrdlvkvvkky
aeeakvavrnvrrdgnddlkklekageiteddlrgytediqketdkyiakvdeiaknkek
eimev

Timeline for d4gfqa1:

• d4gfqa1 first appeared in SCOPe 2.03, called d4gfqa_
  
• d4gfqa1 appears in SCOPe 2.07