SCOPe 2.06: Domain d4gfdb_: 4gfd B:

Lineage for d4gfdb_ (4gfd B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries)

8. Domain d4gfdb_: 4gfd B: [221884]
   automated match to d2ccka_
   complexed with 0yb

Details for d4gfdb_

PDB Entry: 4gfd, 1.8 Å

PDB Description: Thymidylate kinase (TMK) from S. Aureus in complex with TK-666

PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4gfdb_:

Sequence, based on SEQRES records:

>d4gfdb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records):

>d4gfdb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegdmdirte
amlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefaing
lypdltiylnvsaevgreridqedlkfhekviegyqeiihnesqrfksvnadqplenvve
dtyqtiikyleki

Timeline for d4gfdb_:

• d4gfdb_ first appeared in SCOPe 2.03
  
• d4gfdb_ appears in SCOPe 2.05
  
• d4gfdb_ appears in SCOPe 2.07
  
• d4gfdb_ appears in the current release, SCOPe 2.08