Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries) |
Domain d4gfda_: 4gfd A: [221883] automated match to d2ccka_ complexed with 0yb |
PDB Entry: 4gfd (more details), 1.8 Å
SCOPe Domain Sequences for d4gfda_:
Sequence, based on SEQRES records: (download)
>d4gfda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv nadqplenvvedtyqtiikylek
>d4gfda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegmdirtea mlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefaingl ypdltiylnvsaevgreriidqedlkfhekviegyqeiihqrfksvnadqplenvvedty qtiikylek
Timeline for d4gfda_: