Lineage for d4gfda_ (4gfd A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366552Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries)
  8. 1366555Domain d4gfda_: 4gfd A: [221883]
    automated match to d2ccka_
    complexed with 0yb

Details for d4gfda_

PDB Entry: 4gfd (more details), 1.8 Å

PDB Description: Thymidylate kinase (TMK) from S. Aureus in complex with TK-666
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4gfda_:

Sequence, based on SEQRES records: (download)

>d4gfda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Sequence, based on observed residues (ATOM records): (download)

>d4gfda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegmdirtea
mlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefaingl
ypdltiylnvsaevgreriidqedlkfhekviegyqeiihqrfksvnadqplenvvedty
qtiikylek

SCOPe Domain Coordinates for d4gfda_:

Click to download the PDB-style file with coordinates for d4gfda_.
(The format of our PDB-style files is described here.)

Timeline for d4gfda_: