SCOPe 2.05: Domain d4getd_: 4get D:

Lineage for d4getd_ (4get D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Rhodnius prolixus [TaxId:13249] [193297] (8 PDB entries)

8. Domain d4getd_: 4get D: [221881]
   automated match to d4ge1a_
   complexed with trs

Details for d4getd_

PDB Entry: 4get, 2.24 Å

PDB Description: crystal structure of biogenic amine binding protein from rhodnius prolixus

PDB Compounds: (D:) Biogenic amine-binding protein

SCOPe Domain Sequences for d4getd_:

Sequence; same for both SEQRES and ATOM records:

>d4getd_ b.60.1.0 (D:) automated matches {Rhodnius prolixus [TaxId: 13249]}
sgcstvdtvkdfnkdnfftgswyithyklgdstlevgdknctkflhqktadgkikevfsn
ynpnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysv
vhvcdpaapdyylyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqydde
tlqkllkqsfpnye

Timeline for d4getd_:

• d4getd_ first appeared in SCOPe 2.03
  
• d4getd_ appears in SCOPe 2.04
  
• d4getd_ appears in SCOPe 2.06
  
• d4getd_ appears in the current release, SCOPe 2.08