Lineage for d4ge9c1 (4ge9 C:1-425)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897228Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries)
  8. 2897275Domain d4ge9c1: 4ge9 C:1-425 [221873]
    Other proteins in same PDB: d4ge9a2, d4ge9b2, d4ge9c2, d4ge9d2
    automated match to d4gebb_
    complexed with 0l0

Details for d4ge9c1

PDB Entry: 4ge9 (more details), 2.43 Å

PDB Description: Kynurenine Aminotransferase II Inhibitors
PDB Compounds: (C:) kynurenine/alpha-aminoadipate aminotransferase, mitochondrial

SCOPe Domain Sequences for d4ge9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ge9c1 c.67.1.0 (C:1-425) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt
iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg
lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp
edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns
grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq
lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv
kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql
ikesl

SCOPe Domain Coordinates for d4ge9c1:

Click to download the PDB-style file with coordinates for d4ge9c1.
(The format of our PDB-style files is described here.)

Timeline for d4ge9c1: