Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (66 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188446] (16 PDB entries) |
Domain d4ge9a_: 4ge9 A: [221871] automated match to d4gebb_ complexed with 0l0 |
PDB Entry: 4ge9 (more details), 2.43 Å
SCOPe Domain Sequences for d4ge9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ge9a_ c.67.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mnyarfitaasaarnpspirtmtdilsrgpksmislagglpnpnmfpfktavitvengkt iqfgeemmkralqyspsagipellswlkqlqiklhnpptihyppsqgqmdlcvtsgsqqg lckvfemiinpgdnvlldepaysgtlqslhplgcniinvasdesgivpdslrdilsrwkp edaknpqkntpkflytvpngnnptgnsltserkkeiyelarkydfliieddpyyflqfns grvptflsmdvdgrviradsfskiissglrigfltgpkpliervilhiqvstlhpstfnq lmisqllhewgeegfmahvdrvidfysnqkdailaaadkwltglaewhvpaagmflwikv kgindvkelieekavkmgvlmlpgnafyvdssapspylrasfssaspeqmdvafqvlaql ikesllvp
Timeline for d4ge9a_: