| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
| Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
| Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
| Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries) Coagulation factor XIII, |
| Domain d1qrka2: 1qrk A:517-627 [22187] Other proteins in same PDB: d1qrka1, d1qrka4, d1qrkb1, d1qrkb4 complexed with sr |
PDB Entry: 1qrk (more details), 2.5 Å
SCOPe Domain Sequences for d1qrka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrka2 b.1.5.1 (A:517-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
nvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdvt
leplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d1qrka2:
View in 3DDomains from other chains: (mouse over for more information) d1qrkb1, d1qrkb2, d1qrkb3, d1qrkb4 |