SCOPe 2.03: Domain d4ge0d_: 4ge0 D:

Lineage for d4ge0d_ (4ge0 D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (10 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (3 PDB entries)

8. Domain d4ge0d_: 4ge0 D: [221862]
   automated match to d2ab0a1
   complexed with edo, mg; mutant

Details for d4ge0d_

PDB Entry: 4ge0, 1.45 Å

PDB Description: schizosaccharomyces pombe dj-1 t114p mutant

PDB Compounds: (D:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4ge0d_:

Sequence; same for both SEQRES and ATOM records:

>d4ge0d_ c.23.16.0 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagpltaktsg
lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
navykslsmp

Timeline for d4ge0d_:

• d4ge0d_ is new in SCOPe 2.03-stable
  
• d4ge0d_ appears in SCOPe 2.04
  
• d4ge0d_ appears in the current release, SCOPe 2.08