Lineage for d4ge0a_ (4ge0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840750Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1840751Protein automated matches [190197] (18 species)
    not a true protein
  7. 1840865Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (3 PDB entries)
  8. 1840870Domain d4ge0a_: 4ge0 A: [221859]
    automated match to d2ab0a1
    complexed with edo, mg; mutant

Details for d4ge0a_

PDB Entry: 4ge0 (more details), 1.45 Å

PDB Description: schizosaccharomyces pombe dj-1 t114p mutant
PDB Compounds: (A:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4ge0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ge0a_ c.23.16.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagpltaktsg
lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
navykslsmp

SCOPe Domain Coordinates for d4ge0a_:

Click to download the PDB-style file with coordinates for d4ge0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ge0a_: