SCOP 1.55: Domain d1ggyb2: 1ggy B:516-627

Lineage for d1ggyb2 (1ggy B:516-627)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.5: Transglutaminase [49309] (1 family)

5. Family b.1.5.1: Transglutaminase [49310] (1 protein)

6. Protein Coagulation factor XIII, two C-terminal domains [49311] (1 species)

7. Species Human (Homo sapiens), blood [TaxId:9606] [49312] (7 PDB entries)

8. Domain d1ggyb2: 1ggy B:516-627 [22185]
   Other proteins in same PDB: d1ggya1, d1ggya4, d1ggyb1, d1ggyb4

Details for d1ggyb2

PDB Entry: 1ggy, 2.5 Å

PDB Description: human factor xiii with ytterbium bound in the ion site

SCOP Domain Sequences for d1ggyb2:

Sequence; same for both SEQRES and ATOM records:

>d1ggyb2 b.1.5.1 (B:516-627) Coagulation factor XIII, two C-terminal domains {Human (Homo sapiens), blood}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

Timeline for d1ggyb2:

• d1ggyb2 appears in SCOP 1.57
  
• d1ggyb2 appears in the current release, SCOPe 2.08